PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 268aa    MW: 29683.8 Da    PI: 8.5631
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679659PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-16829PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-18123177256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tk q   Lee+F+ +++++ ++++eLA++l+L  rqV vWFqNrRa+ k
  Lsa010840 123 RKKLRLTKAQSVLLEEAFKHHSTLNPKQKQELARELKLRPRQVEVWFQNRRARTK 177
                678899***********************************************98 PP

2HD-ZIP_I/II1215.9e-39123212191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+k q+ lLEe F+++++L+p++K+elareL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk++++alkeen+rL+ke +eL+ +l
    Lsa010840 123 RKKLRLTKAQSVLLEEAFKHHSTLNPKQKQELARELKLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCEALKEENSRLHKELQELK-AL 212
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.022119179IPR001356Homeobox domain
SuperFamilySSF466893.68E-18121188IPR009057Homeodomain-like
SMARTSM003892.9E-15121183IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-17121182IPR009057Homeodomain-like
PfamPF000465.9E-16123177IPR001356Homeobox domain
CDDcd000863.92E-15123180No hitNo description
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
SMARTSM003402.3E-20179222IPR003106Leucine zipper, homeobox-associated
PfamPF021832.9E-10179213IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGLVLELGLN SSSSSMAENT SINPTKKPCS SLSFEPCLTL AVSGDLDHLK KPPCVGGGVG  60
GGGDLYRQDS LSGGCSSFSV ASVSVKRERE VKSEDSERVS RVFRTSVHEH EVDDDDDATV  120
NGRKKLRLTK AQSVLLEEAF KHHSTLNPKQ KQELARELKL RPRQVEVWFQ NRRARTKLKQ  180
TEVDCEYLKK CCEALKEENS RLHKELQELK ALKLSTQPLY MQLPAATLTM CPSCERIGDT  240
TSSTKSRPFT MAPKPHLFNP FANSSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171179RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271511.23e-97PREDICTED: homeobox-leucine zipper protein HAT22 isoform X2
SwissprotP466045e-80HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A124SC201e-106A0A124SC20_CYNCS; Homeodomain-containing protein
STRINGVIT_00s0732g00010.t011e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-73HD-ZIP family protein